PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK03341.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 268aa    MW: 30987.3 Da    PI: 5.0624
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK03341.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.95.5e-5561331128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                lppGfrFhPtdeelv++yLk+k++g+++el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyWk+tgkd++v++ +++
  PK03341.1   6 LPPGFRFHPTDEELVNYYLKRKINGQEIEL-DIIPEVDLYKCEPWELAeKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYWKSTGKDRRVTC-QNR 103
                79****************************.99**************84335556888**************************************.899 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                ++g+kktLv+y+grap+g +tdWvmheyrl
  PK03341.1 104 AIGMKKTLVYYRGRAPQGIRTDWVMHEYRL 133
                9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.18E-624163IPR003441NAC domain
PROSITE profilePS5100559.8556163IPR003441NAC domain
PfamPF023653.2E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MSPVGLPPGF RFHPTDEELV NYYLKRKING QEIELDIIPE VDLYKCEPWE LAEKSFLPSR  60
DPEWYFFGPR DRKYPNGFRT NRATRAGYWK STGKDRRVTC QNRAIGMKKT LVYYRGRAPQ  120
GIRTDWVMHE YRLDDKDSED HTSAIQAYNK MQDSYALCRV FKKNGICSEV EEQQQQQLLA  180
QCNTNNNNIS LMESSTSHNS HGGFINESDT MSPDIPMASS SCIEQDDDKD DSWMQFITDD  240
DSWCQSNTTT TTTIGAHDDV SRHISFTN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-56416413169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00363DAPTransfer from AT3G17730Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015883764.11e-141PREDICTED: NAC domain-containing protein 86
SwissprotQ9FFI57e-91NAC86_ARATH; NAC domain-containing protein 86
TrEMBLU5FPE31e-140U5FPE3_POPTR; No apical meristem family protein
STRINGPOPTR_0015s05450.11e-140(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95643343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-124NAC domain containing protein 57